PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0037s0113.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family Trihelix
Protein Properties Length: 896aa    MW: 98053 Da    PI: 8.289
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0037s0113.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix59.58.2e-19789873186
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                          +W   e+l+Li++r+ me ++++g++kk+lW+ vs ++ + gf r+p+qC + w++l k+y+ + e  k++   s++ + y+d +e
  Mapoly0037s0113.1.p 789 KWRIVETLELIKVRSGMEAEVQSGQSKKALWKNVSLALTDAGFDRTPEQCCSMWSSLVKKYEIVSEDTKSGV-VSEKPWTYLDAME 873
                          79999*****************************************************************93.44456******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.60.15.101.8E-68101351IPR001279Metallo-beta-lactamase
SuperFamilySSF562812.08E-75102516IPR001279Metallo-beta-lactamase
SMARTSM008491.3E-22114311IPR001279Metallo-beta-lactamase
PfamPF127062.2E-11126261IPR001279Metallo-beta-lactamase
PfamPF075215.9E-9454505IPR011108Zn-dependent metallo-hydrolase, RNA specificity domain
PfamPF138371.5E-12788873No hitNo description
CDDcd122031.85E-15788852No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009942Biological Processlongitudinal axis specification
GO:0060918Biological Processauxin transport
GO:0009507Cellular Componentchloroplast
Sequence ? help Back to Top
Protein Sequence    Length: 896 aa     Download sequence    Send to blast
MGAPLRSAFL GCSCGSPVMA HALPASNLAF LGKFGGGSFH EIILESRRER NGFNKIRASA  60
TRQAPRESRR YRGIAEGANR SRDDAVQRKM KAFHEGAEGP PLRVLPIGGL GEIGMNCMLV  120
GNYDRYIMID AGLMFPDFDE LGVQKVLPDT AFIRRWAHKI EALVITHGHE DHIGALPWVV  180
PALDPKTPIY STGFTMQLIK ARLKEHNIPF EGRCKTVSMR GRFQAGPFEV EPIRVTHSIP  240
DCCGLVLRCQ DGTIFHTGDW KIDESPVDGN IFDRVALEQL AKEGVTLMMS DSTNVLSPGR  300
TTSEADVAKA LMQRIYSAKG RVITTQFASN VHRLGSVKEA AEASGRKLVF IGVSLKTYLD  360
AAWKDGQAPF DPSLLVKAED MGAYSPRDLL IVTTGSQAEP RAALNLASFG TSRSLKLNKD  420
DLVLYSAKMI PGNETRVVRM MNRIAELGPT IIQGRGENLH TSGHAYRGEL EEVLRLVKPQ  480
HFLPVHGEFA FLKEHELLGK ANGIRHTTVI KNGEMLGVSP LRNGRVLSSG FSALGRENLK  540
LMYNDGDRAF GTAADLCVQE RMQVALEGLV VASVEIFRDP TVAPADAEND QDSYDQEGMG  600
LRGRVRITTR CMWIDGGRLL DYLRQAVDGA LASCYLDSTL PQIERKIGTA IKKAAQKYIN  660
RRPEVIVIAS EASPNSAPPS KVTTKVVAPP PAPHRFGKFV PQNNGTVKSP TKRKDSEEVE  720
ARSTAVTVSS PVDDQTEEEV QTTVVSDVTP LEVPSVSETT ESKSSTTETT AATDAATSAS  780
EAPSRRIRKW RIVETLELIK VRSGMEAEVQ SGQSKKALWK NVSLALTDAG FDRTPEQCCS  840
MWSSLVKKYE IVSEDTKSGV VSEKPWTYLD AMEKAMAIRR ELIRTNPDTP QVAAN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5a0t_A6e-8410251019423RIBONUCLEASE J
5a0t_B6e-8410251019423RIBONUCLEASE J
5a0v_A6e-8410251019423RIBONUCLEASE J
5a0v_B6e-8410251019423RIBONUCLEASE J
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001775526.10.0predicted protein, partial
TrEMBLA9TA910.0A9TA91_PHYPA; Predicted protein (Fragment)
STRINGEFJ238040.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP30821521
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63420.10.0Trihelix family protein